PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OMERI02G06420.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 330aa    MW: 35791 Da    PI: 9.3862
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OMERI02G06420.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.42.3e-3971148178
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                      +CqvegC ++l  +k+yhr+h+vCe+hsk p+v+v+g+e+rfCqqCsrfh+lsefD++krsCrrrL +hn+rrrk+q+
  OMERI02G06420.1  71 RCQVEGCGVELVGVKDYHRKHRVCEAHSKFPHVVVAGQERRFCQQCSRFHALSEFDQKKRSCRRRLYDHNARRRKPQT 148
                      6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.3E-3364133IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.5369146IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-3870152IPR004333Transcription factor, SBP-box
PfamPF031101.3E-3072145IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MDWMPPPKPT SPRSPPLLWD WADAAVPGSS SGEVSAAAAA AAHPGRRRKE KRGRAEEGGG  60
GGGGGGGGEV RCQVEGCGVE LVGVKDYHRK HRVCEAHSKF PHVVVAGQER RFCQQCSRFH  120
ALSEFDQKKR SCRRRLYDHN ARRRKPQTDV FSYASARPPS SLLFDDSRQI SFVWNKAPLN  180
HVRPFAISPW ESSSEVGATD GHIYLDKSHL SKSLPAFNTN IDELLRIKGP DASLTASKFD  240
GAPDLQRALS LLSSSSCGLP DPVQQASRVI QFTGTSQNNR ELPPLNGGNS ASASCANVQT  300
IAQPAQLVRF TMDASSNACQ SNFFGLNQIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-2562145184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
14550RRRKEK
2127144KKRSCRRRLYDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0614840.0AK061484.1 Oryza sativa Japonica Group cDNA clone:006-308-H09, full insert sequence.
GenBankAK0660570.0AK066057.1 Oryza sativa Japonica Group cDNA clone:J013053E16, full insert sequence.
GenBankAK0687020.0AK068702.1 Oryza sativa Japonica Group cDNA clone:J013159I15, full insert sequence.
GenBankHQ8588100.0HQ858810.1 Oryza sativa Japonica Group isolate UT1190 SBP transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015623076.10.0PREDICTED: squamosa promoter-binding-like protein 4 isoform X2
SwissprotQ6H5091e-135SPL4_ORYSJ; Squamosa promoter-binding-like protein 4
TrEMBLA0A0E0CGF70.0A0A0E0CGF7_9ORYZ; Uncharacterized protein
STRINGBGIOSGA007643-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62712952
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.34e-37squamosa promoter binding protein-like 2